Anti GRIK2 pAb (ATL-HPA014623)

Atlas Antibodies

SKU:
ATL-HPA014623-25
  • Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glutamate receptor, ionotropic, kainate 2
Gene Name: GRIK2
Alternative Gene Name: GluK2, GLUR6, MRT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056073: 99%, ENSRNOG00000000368: 100%
Entrez Gene ID: 2898
Uniprot ID: Q13002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLL
Gene Sequence ITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLL
Gene ID - Mouse ENSMUSG00000056073
Gene ID - Rat ENSRNOG00000000368
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GRIK2 pAb (ATL-HPA014623)
Datasheet Anti GRIK2 pAb (ATL-HPA014623) Datasheet (External Link)
Vendor Page Anti GRIK2 pAb (ATL-HPA014623) at Atlas Antibodies

Documents & Links for Anti GRIK2 pAb (ATL-HPA014623)
Datasheet Anti GRIK2 pAb (ATL-HPA014623) Datasheet (External Link)
Vendor Page Anti GRIK2 pAb (ATL-HPA014623)