Anti GRIA1 pAb (ATL-HPA035202)

Atlas Antibodies

SKU: ATL-HPA035202-25

• 

Protein Description: glutamate receptor, ionotropic, AMPA 1
Gene Name: GRIA1
Alternative Gene Name: GluA1, GLUR1, GLURA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020524: 100%, ENSRNOG00000045816: 100%
Entrez Gene ID: 2890
Uniprot ID: P42261
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN
• Gene Sequence: VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN
• Gene ID - Mouse: ENSMUSG00000020524
• Gene ID - Rat: ENSRNOG00000045816
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.