Anti GRHPR pAb (ATL-HPA022971)

Atlas Antibodies

SKU: ATL-HPA022971-25

• 
• 
• 

Protein Description: glyoxylate reductase/hydroxypyruvate reductase
Gene Name: GRHPR
Alternative Gene Name: GLXR, PH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035637: 90%, ENSRNOG00000012794: 92%
Entrez Gene ID: 9380
Uniprot ID: Q9UBQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL
• Gene Sequence: GDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL
• Gene ID - Mouse: ENSMUSG00000035637
• Gene ID - Rat: ENSRNOG00000012794
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.