Anti GRHL2 pAb (ATL-HPA004820)

Atlas Antibodies

SKU:
ATL-HPA004820-25
  • Immunohistochemical staining of human urinary bladder shows  strong nuclear positivity in urothelial cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: grainyhead-like 2 (Drosophila)
Gene Name: GRHL2
Alternative Gene Name: BOM, DFNA28, FLJ13782, TFCP2L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022286: 87%, ENSRNOG00000007000: 87%
Entrez Gene ID: 79977
Uniprot ID: Q6ISB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQK
Gene Sequence NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQK
Gene ID - Mouse ENSMUSG00000022286
Gene ID - Rat ENSRNOG00000007000
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GRHL2 pAb (ATL-HPA004820)
Datasheet Anti GRHL2 pAb (ATL-HPA004820) Datasheet (External Link)
Vendor Page Anti GRHL2 pAb (ATL-HPA004820) at Atlas Antibodies

Documents & Links for Anti GRHL2 pAb (ATL-HPA004820)
Datasheet Anti GRHL2 pAb (ATL-HPA004820) Datasheet (External Link)
Vendor Page Anti GRHL2 pAb (ATL-HPA004820)



Citations for Anti GRHL2 pAb (ATL-HPA004820) – 34 Found
Gao, Xia; Bali, Aman S; Randell, Scott H; Hogan, Brigid L M. GRHL2 coordinates regeneration of a polarized mucociliary epithelium from basal stem cells. The Journal Of Cell Biology. 2015;211(3):669-82.  PubMed
Chung, Vin Yee; Tan, Tuan Zea; Tan, Ming; Wong, Meng Kang; Kuay, Kuee Theng; Yang, Zhe; Ye, Jieru; Muller, Julius; Koh, Cheryl M; Guccione, Ernesto; Thiery, Jean Paul; Huang, Ruby Yun-Ju. GRHL2-miR-200-ZEB1 maintains the epithelial status of ovarian cancer through transcriptional regulation and histone modification. Scientific Reports. 2016;6( 26887977):19943.  PubMed
Paltoglou, Steve; Das, Rajdeep; Townley, Scott L; Hickey, Theresa E; Tarulli, Gerard A; Coutinho, Isabel; Fernandes, Rayzel; Hanson, Adrienne R; Denis, Iza; Carroll, Jason S; Dehm, Scott M; Raj, Ganesh V; Plymate, Stephen R; Tilley, Wayne D; Selth, Luke A. Novel Androgen Receptor Coregulator GRHL2 Exerts Both Oncogenic and Antimetastatic Functions in Prostate Cancer. Cancer Research. 2017;77(13):3417-3430.  PubMed
Chen, Amy F; Liu, Arthur J; Krishnakumar, Raga; Freimer, Jacob W; DeVeale, Brian; Blelloch, Robert. GRHL2-Dependent Enhancer Switching Maintains a Pluripotent Stem Cell Transcriptional Subnetwork after Exit from Naive Pluripotency. Cell Stem Cell. 2018;23(2):226-238.e4.  PubMed
Helzer, Kyle T; Szatkowski Ozers, Mary; Meyer, Mark B; Benkusky, Nancy A; Solodin, Natalia; Reese, Rebecca M; Warren, Christopher L; Pike, J Wesley; Alarid, Elaine T. The Phosphorylated Estrogen Receptor α (ER) Cistrome Identifies a Subset of Active Enhancers Enriched for Direct ER-DNA Binding and the Transcription Factor GRHL2. Molecular And Cellular Biology. 2019;39(3)  PubMed
Holding, Andrew N; Giorgi, Federico M; Donnelly, Amanda; Cullen, Amy E; Nagarajan, Sankari; Selth, Luke A; Markowetz, Florian. VULCAN integrates ChIP-seq with patient-derived co-expression networks to identify GRHL2 as a key co-regulator of ERa at enhancers in breast cancer. Genome Biology. 2019;20(1):91.  PubMed
Nikolopoulou, Evanthia; Hirst, Caroline S; Galea, Gabriel; Venturini, Christina; Moulding, Dale; Marshall, Abigail R; Rolo, Ana; De Castro, Sandra C P; Copp, Andrew J; Greene, Nicholas D E. Spinal neural tube closure depends on regulation of surface ectoderm identity and biomechanics by Grhl2. Nature Communications. 2019;10(1):2487.  PubMed
Singh, Balraj; Sarli, Vanessa N; Kinne, Hannah E; Shamsnia, Anna; Lucci, Anthony. Evaluation of 6-mercaptopurine in a cell culture model of adaptable triple-negative breast cancer with metastatic potential. Oncotarget. 2019;10(38):3681-3693.  PubMed
Chung, Vin Yee; Tan, Tuan Zea; Ye, Jieru; Huang, Rui-Lan; Lai, Hung-Cheng; Kappei, Dennis; Wollmann, Heike; Guccione, Ernesto; Huang, Ruby Yun-Ju. The role of GRHL2 and epigenetic remodeling in epithelial-mesenchymal plasticity in ovarian cancer cells. Communications Biology. 2( 31372511):272.  PubMed
Paull, Evan O; Aytes, Alvaro; Jones, Sunny J; Subramaniam, Prem S; Giorgi, Federico M; Douglass, Eugene F; Tagore, Somnath; Chu, Brennan; Vasciaveo, Alessandro; Zheng, Siyuan; Verhaak, Roel; Abate-Shen, Cory; Alvarez, Mariano J; Califano, Andrea. A modular master regulator landscape controls cancer transcriptional identity. Cell. 2021;184(2):334-351.e20.  PubMed
Matsuoka, Shinya; Suzuki, Hiroyoshi; Kato, Chieko; Kamikawa-Tokai, Mai; Kamikawa, Akihiro; Okamatsu-Ogura, Yuko; Kimura, Kazuhiro. Expression of Grainyhead-like 2 in the Process of Ductal Development of Mouse Mammary Gland. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2021;69(6):373-388.  PubMed
Pang, Qing You; Tan, Tuan Zea; Sundararajan, Vignesh; Chiu, Yi-Chia; Chee, Edward Yu Wing; Chung, Vin Yee; Choolani, Mahesh A; Huang, Ruby Yun-Ju. 3D genome organization in the epithelial-mesenchymal transition spectrum. Genome Biology. 2022;23(1):121.  PubMed
Varma, Saaket; Cao, Yuxia; Tagne, Jean-Bosco; Lakshminarayanan, Meenakshi; Li, Jun; Friedman, Thomas B; Morell, Robert J; Warburton, David; Kotton, Darrell N; Ramirez, Maria I. The transcription factors Grainyhead-like 2 and NK2-homeobox 1 form a regulatory loop that coordinates lung epithelial cell morphogenesis and differentiation. The Journal Of Biological Chemistry. 2012;287(44):37282-95.  PubMed
Gao, Xia; Vockley, Christopher M; Pauli, Florencia; Newberry, Kimberly M; Xue, Yan; Randell, Scott H; Reddy, Timothy E; Hogan, Brigid L M. Evidence for multiple roles for grainyhead-like 2 in the establishment and maintenance of human mucociliary airway epithelium.[corrected]. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2013;110(23):9356-61.  PubMed
Cieply, Benjamin; Farris, Joshua; Denvir, James; Ford, Heide L; Frisch, Steven M. Epithelial-mesenchymal transition and tumor suppression are controlled by a reciprocal feedback loop between ZEB1 and Grainyhead-like-2. Cancer Research. 2013;73(20):6299-309.  PubMed
Varma, Saaket; Mahavadi, Poornima; Sasikumar, Satish; Cushing, Leah; Hyland, Tessa; Rosser, Ann E; Riccardi, Daniela; Lu, Jining; Kalin, Tanya V; Kalinichenko, Vladimir V; Guenther, Andreas; Ramirez, Maria I; Pardo, Annie; Selman, Moisés; Warburton, David. Grainyhead-like 2 (GRHL2) distribution reveals novel pathophysiological differences between human idiopathic pulmonary fibrosis and mouse models of pulmonary fibrosis. American Journal Of Physiology. Lung Cellular And Molecular Physiology. 2014;306(5):L405-19.  PubMed
Quan, Yingjun; Jin, Runsen; Huang, Ao; Zhao, Hongchao; Feng, Bo; Zang, Lu; Zheng, Minhua. Downregulation of GRHL2 inhibits the proliferation of colorectal cancer cells by targeting ZEB1. Cancer Biology & Therapy. 2014;15(7):878-87.  PubMed
Torres-Reyes, Luis A; Alvarado-Ruiz, Liliana; Piña-Sánchez, Patricia; Martínez-Silva, María G; Ramos-Solano, Moisés; Olimón-Andalón, Vicente; Ortiz-Lazareno, Pablo C; Hernández-Flores, Georgina; Bravo-Cuellar, Alejandro; Aguilar-Lemarroy, Adriana; Jave-Suarez, Luis F. Expression of transcription factor grainyhead-like 2 is diminished in cervical cancer. International Journal Of Clinical And Experimental Pathology. 7(11):7409-18.  PubMed
Quan, Yingjun; Xu, Ming; Cui, Peng; Ye, Min; Zhuang, Biao; Min, Zhijun. Grainyhead-like 2 Promotes Tumor Growth and is Associated with Poor Prognosis in Colorectal Cancer. Journal Of Cancer. 6(4):342-50.  PubMed
Hosoya, Makoto; Fujioka, Masato; Ogawa, Kaoru; Okano, Hideyuki. Distinct Expression Patterns Of Causative Genes Responsible For Hereditary Progressive Hearing Loss In Non-Human Primate Cochlea. Scientific Reports. 2016;6( 26915689):22250.  PubMed
Jozwik, Kamila M; Chernukhin, Igor; Serandour, Aurelien A; Nagarajan, Sankari; Carroll, Jason S. FOXA1 Directs H3K4 Monomethylation at Enhancers via Recruitment of the Methyltransferase MLL3. Cell Reports. 2016;17(10):2715-2723.  PubMed
Nishino, Hitoe; Takano, Shigetsugu; Yoshitomi, Hideyuki; Suzuki, Kensuke; Kagawa, Shingo; Shimazaki, Reiri; Shimizu, Hiroaki; Furukawa, Katsunori; Miyazaki, Masaru; Ohtsuka, Masayuki. Grainyhead-like 2 (GRHL2) regulates epithelial plasticity in pancreatic cancer progression. Cancer Medicine. 2017;6(11):2686-2696.  PubMed
Liskova, Petra; Dudakova, Lubica; Evans, Cerys J; Rojas Lopez, Karla E; Pontikos, Nikolas; Athanasiou, Dimitra; Jama, Hodan; Sach, Josef; Skalicka, Pavlina; Stranecky, Viktor; Kmoch, Stanislav; Thaung, Caroline; Filipec, Martin; Cheetham, Michael E; Davidson, Alice E; Tuft, Stephen J; Hardcastle, Alison J. Ectopic GRHL2 Expression Due to Non-coding Mutations Promotes Cell State Transition and Causes Posterior Polymorphous Corneal Dystrophy 4. American Journal Of Human Genetics. 2018;102(3):447-459.  PubMed
MacFawn, Ian; Wilson, Hannah; Selth, Luke A; Leighton, Ian; Serebriiskii, Ilya; Bleackley, R Christopher; Elzamzamy, Osama; Farris, Joshua; Pifer, Phillip M; Richer, Jennifer; Frisch, Steven M. Grainyhead-like-2 confers NK-sensitivity through interactions with epigenetic modifiers. Molecular Immunology. 2019;105( 30508726):137-149.  PubMed
Chi, David; Singhal, Hari; Li, Lewyn; Xiao, Tengfei; Liu, Weihan; Pun, Matthew; Jeselsohn, Rinath; He, Housheng; Lim, Elgene; Vadhi, Raga; Rao, Prakash; Long, Henry; Garber, Judy; Brown, Myles. Estrogen receptor signaling is reprogrammed during breast tumorigenesis. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2019;116(23):11437-11443.  PubMed
Cocce, Kimberly J; Jasper, Jeff S; Desautels, Taylor K; Everett, Logan; Wardell, Suzanne; Westerling, Thomas; Baldi, Robert; Wright, Tricia M; Tavares, Kendall; Yllanes, Alex; Bae, Yeeun; Blitzer, Jeremy T; Logsdon, Craig; Rakiec, Daniel P; Ruddy, David A; Jiang, Tiancong; Broadwater, Gloria; Hyslop, Terry; Hall, Allison; Laine, Muriel; Phung, Linda; Greene, Geoffrey L; Martin, Lesley-Ann; Pancholi, Sunil; Dowsett, Mitch; Detre, Simone; Marks, Jeffrey R; Crawford, Gregory E; Brown, Myles; Norris, John D; Chang, Ching-Yi; McDonnell, Donald P. The Lineage Determining Factor GRHL2 Collaborates with FOXA1 to Establish a Targetable Pathway in Endocrine Therapy-Resistant Breast Cancer. Cell Reports. 2019;29(4):889-903.e10.  PubMed
Carpinelli, Marina R; de Vries, Michael E; Auden, Alana; Butt, Tariq; Deng, Zihao; Partridge, Darren D; Miles, Lee B; Georgy, Smitha R; Haigh, Jody J; Darido, Charbel; Brabletz, Simone; Brabletz, Thomas; Stemmler, Marc P; Dworkin, Sebastian; Jane, Stephen M. Inactivation of Zeb1 in GRHL2-deficient mouse embryos rescues mid-gestation viability and secondary palate closure. Disease Models & Mechanisms. 2020;13(3)  PubMed
Zhang, Yusheng; Chan, Ho Lam; Garcia-Martinez, Liliana; Karl, Daniel L; Weich, Natalia; Slingerland, Joyce M; Verdun, Ramiro E; Morey, Lluis. Estrogen induces dynamic ERα and RING1B recruitment to control gene and enhancer activities in luminal breast cancer. Science Advances. 2020;6(23):eaaz7249.  PubMed
Huang, Huaxing; Liu, Jiafeng; Li, Mingsen; Guo, Huizhen; Zhu, Jin; Zhu, Liqiong; Wu, Siqi; Mo, Kunlun; Huang, Ying; Tan, Jieying; Chen, Chaoqun; Wang, Bofeng; Yu, Yankun; Wang, Li; Liu, Yizhi; Ouyang, Hong. Cis-regulatory chromatin loops analysis identifies GRHL3 as a master regulator of surface epithelium commitment. Science Advances. 2022;8(28):eabo5668.  PubMed
Wang, Zi; Coban, Bircan; Wu, Haoyu; Chouaref, Jihed; Daxinger, Lucia; Paulsen, Michelle T; Ljungman, Mats; Smid, Marcel; Martens, John W M; Danen, Erik H J. GRHL2-controlled gene expression networks in luminal breast cancer. Cell Communication And Signaling : Ccs. 2023;21(1):15.  PubMed
Wang, Zi; Coban, Bircan; Liao, Chen-Yi; Chen, Yao-Jun; Liu, Qiuyu; Danen, Erik H J. GRHL2 Regulation of Growth/Motility Balance in Luminal versus Basal Breast Cancer. International Journal Of Molecular Sciences. 2023;24(3)  PubMed
Collier, Ann E; Piekos, Samantha N; Liu, Angela; Pattison, Jillian M; Felix, Franco; Bailetti, Alessandro A; Sedov, Egor; Gaddam, Sadhana; Zhen, Hanson; Oro, Anthony E. GRHL2 and AP2a coordinate early surface ectoderm lineage commitment during development. Iscience. 2023;26(3):106125.  PubMed
Wang, Qi; Zhang, Yang; Zhang, Bolei; Fu, Yao; Zhao, Xiaozhi; Zhang, Jing; Zuo, Ke; Xing, Yuexian; Jiang, Song; Qin, Zhaohui; Li, Erguang; Guo, Hongqian; Liu, Zhihong; Yang, Jingping. Single-cell chromatin accessibility landscape in kidney identifies additional cell-of-origin in heterogenous papillary renal cell carcinoma. Nature Communications. 2022;13(1):31.  PubMed
Reese, Rebecca M; Helzer, Kyle T; Allen, Kaelyn O; Zheng, Christy; Solodin, Natalia; Alarid, Elaine T. GRHL2 Enhances Phosphorylated Estrogen Receptor (ER) Chromatin Binding and Regulates ER-Mediated Transcriptional Activation and Repression. Molecular And Cellular Biology. 2022;42(10):e0019122.  PubMed