Anti GRHL1 pAb (ATL-HPA006420 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA006420-25

• 
• 
• 

Protein Description: grainyhead-like 1 (Drosophila)
Gene Name: GRHL1
Alternative Gene Name: LBP-32, MGR, TFCP2L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020656: 93%, ENSRNOG00000054989: 92%
Entrez Gene ID: 29841
Uniprot ID: Q9NZI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTVSIATMPTHSIKTETQPHGFAVGIPPAVYHPEPTERVVVFDRNLNTDQFSSGAQAPNAQRRTPDSTFSETFKEGVQEVFFPSDLSLRMPGMNSEDYVFDSVSGNNFEYTLEASKSLRQKPGDSTMTYLNK
• Gene Sequence: VTVSIATMPTHSIKTETQPHGFAVGIPPAVYHPEPTERVVVFDRNLNTDQFSSGAQAPNAQRRTPDSTFSETFKEGVQEVFFPSDLSLRMPGMNSEDYVFDSVSGNNFEYTLEASKSLRQKPGDSTMTYLNK
• Gene ID - Mouse: ENSMUSG00000020656
• Gene ID - Rat: ENSRNOG00000054989
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GRHL1 pAb (ATL-HPA006420 w/enhanced validation) – 1 Found

Gao, Xia; Vockley, Christopher M; Pauli, Florencia; Newberry, Kimberly M; Xue, Yan; Randell, Scott H; Reddy, Timothy E; Hogan, Brigid L M. Evidence for multiple roles for grainyhead-like 2 in the establishment and maintenance of human mucociliary airway epithelium.[corrected]. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2013;110(23):9356-61.