Anti GRHL1 pAb (ATL-HPA005798 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA005798-25

• 
• 

Protein Description: grainyhead-like 1 (Drosophila)
Gene Name: GRHL1
Alternative Gene Name: LBP-32, MGR, TFCP2L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020656: 88%, ENSRNOG00000054989: 87%
Entrez Gene ID: 29841
Uniprot ID: Q9NZI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLPIASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGL
• Gene Sequence: TVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLPIASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGL
• Gene ID - Mouse: ENSMUSG00000020656
• Gene ID - Rat: ENSRNOG00000054989
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GRHL1 pAb (ATL-HPA005798 w/enhanced validation) – 4 Found

Kikulska, Agnieszka; Rausch, Tobias; Krzywinska, Ewa; Pawlak, Magdalena; Wilczynski, Bartek; Benes, Vladimir; Rutkowski, Piotr; Wilanowski, Tomasz. Coordinated expression and genetic polymorphisms in Grainyhead-like genes in human non-melanoma skin cancers. Bmc Cancer. 2018;18(1):23. 

Tran, Quynh T; Kennedy, Lawrence H; Leon Carrion, Sandra; Bodreddigari, Sridevi; Goodwin, Shirlean B; Sutter, Carrie H; Sutter, Thomas R. EGFR regulation of epidermal barrier function. Physiological Genomics. 2012;44(8):455-69. 

Kubota, Kaiyu; Kent, Lindsey N; Rumi, M A Karim; Roby, Katherine F; Soares, Michael J. Dynamic Regulation of AP-1 Transcriptional Complexes Directs Trophoblast Differentiation. Molecular And Cellular Biology. 2015;35(18):3163-77. 

He, Yiming; Gan, Mingxi; Wang, Yanan; Huang, Tong; Wang, Jianbin; Han, Tianyu; Yu, Bentong. EGFR-ERK induced activation of GRHL1 promotes cell cycle progression by up-regulating cell cycle related genes in lung cancer. Cell Death & Disease. 2021;12(5):430.