Anti GREB1L pAb (ATL-HPA044218)

Atlas Antibodies

Catalog No.: ATL-HPA044218-25

Protein Description: growth regulation by estrogen in breast cancer-like
Gene Name: GREB1L
Alternative Gene Name: C18orf6, FLJ13687, KIAA1772
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042942: 95%, ENSRNOG00000023492: 94%
Entrez Gene ID: 80000
Uniprot ID: Q9C091
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVNTLLERYPRLHSMVVRCYLLIQQYSEALMALTTMASLRDHSTPETLSIMDDLISSPGKNKSGRGHMLIIRVPSVQLAMLAKER
• Gene Sequence: MVNTLLERYPRLHSMVVRCYLLIQQYSEALMALTTMASLRDHSTPETLSIMDDLISSPGKNKSGRGHMLIIRVPSVQLAMLAKER
• Gene ID - Mouse: ENSMUSG00000042942
• Gene ID - Rat: ENSRNOG00000023492
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GREB1L pAb (ATL-HPA044218) – 1 Found

Schrauwen, Isabelle; Kari, Elina; Mattox, Jacob; Llaci, Lorida; Smeeton, Joanna; Naymik, Marcus; Raible, David W; Knowles, James A; Crump, J Gage; Huentelman, Matthew J; Friedman, Rick A. De novo variants in GREB1L are associated with non-syndromic inner ear malformations and deafness. Human Genetics. 2018;137(6-7):459-470.