Anti GREB1L pAb (ATL-HPA041647)

Atlas Antibodies

Catalog No.:
ATL-HPA041647-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: growth regulation by estrogen in breast cancer-like
Gene Name: GREB1L
Alternative Gene Name: C18orf6, FLJ13687, KIAA1772
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042942: 84%, ENSRNOG00000023492: 86%
Entrez Gene ID: 80000
Uniprot ID: Q9C091
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEEEINTDHNESSEVSQSEGEPWPDIESFSKMPFDVSVHDPKYSLMSLVYTEKLAGVKQEVIKESKVEEPRKRETVSIMLTKYAAYNT
Gene Sequence DEEEINTDHNESSEVSQSEGEPWPDIESFSKMPFDVSVHDPKYSLMSLVYTEKLAGVKQEVIKESKVEEPRKRETVSIMLTKYAAYNT
Gene ID - Mouse ENSMUSG00000042942
Gene ID - Rat ENSRNOG00000023492
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GREB1L pAb (ATL-HPA041647)
Datasheet Anti GREB1L pAb (ATL-HPA041647) Datasheet (External Link)
Vendor Page Anti GREB1L pAb (ATL-HPA041647) at Atlas Antibodies

Documents & Links for Anti GREB1L pAb (ATL-HPA041647)
Datasheet Anti GREB1L pAb (ATL-HPA041647) Datasheet (External Link)
Vendor Page Anti GREB1L pAb (ATL-HPA041647)