Anti GREB1 pAb (ATL-HPA027843)

Atlas Antibodies

Catalog No.:
ATL-HPA027843-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: growth regulation by estrogen in breast cancer 1
Gene Name: GREB1
Alternative Gene Name: KIAA0575
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036523: 93%, ENSRNOG00000024651: 93%
Entrez Gene ID: 9687
Uniprot ID: Q4ZG55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSCNDSVHVIECAYSLAEGLSEMFRLLVEGKLAKTNYVVIICACRSAAIDSCIAVTGKYQARILSESLLTPAEYQKEVNYELVTGKV
Gene Sequence SSCNDSVHVIECAYSLAEGLSEMFRLLVEGKLAKTNYVVIICACRSAAIDSCIAVTGKYQARILSESLLTPAEYQKEVNYELVTGKV
Gene ID - Mouse ENSMUSG00000036523
Gene ID - Rat ENSRNOG00000024651
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GREB1 pAb (ATL-HPA027843)
Datasheet Anti GREB1 pAb (ATL-HPA027843) Datasheet (External Link)
Vendor Page Anti GREB1 pAb (ATL-HPA027843) at Atlas Antibodies

Documents & Links for Anti GREB1 pAb (ATL-HPA027843)
Datasheet Anti GREB1 pAb (ATL-HPA027843) Datasheet (External Link)
Vendor Page Anti GREB1 pAb (ATL-HPA027843)