Anti GREB1 pAb (ATL-HPA024616)

Atlas Antibodies

SKU:
ATL-HPA024616-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in proximal tubules.
  • Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: growth regulation by estrogen in breast cancer 1
Gene Name: GREB1
Alternative Gene Name: KIAA0575
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036523: 85%, ENSRNOG00000024651: 85%
Entrez Gene ID: 9687
Uniprot ID: Q4ZG55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGDIDILLDKFHQENQGHISSSLAASSVTKAASLDVSGTPVCTSYNLEPHSIRPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFLICIP
Gene Sequence EGDIDILLDKFHQENQGHISSSLAASSVTKAASLDVSGTPVCTSYNLEPHSIRPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFLICIP
Gene ID - Mouse ENSMUSG00000036523
Gene ID - Rat ENSRNOG00000024651
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GREB1 pAb (ATL-HPA024616)
Datasheet Anti GREB1 pAb (ATL-HPA024616) Datasheet (External Link)
Vendor Page Anti GREB1 pAb (ATL-HPA024616) at Atlas Antibodies

Documents & Links for Anti GREB1 pAb (ATL-HPA024616)
Datasheet Anti GREB1 pAb (ATL-HPA024616) Datasheet (External Link)
Vendor Page Anti GREB1 pAb (ATL-HPA024616)



Citations for Anti GREB1 pAb (ATL-HPA024616) – 3 Found
Hodgkinson, Kendra; Forrest, Laura A; Vuong, Nhung; Garson, Kenneth; Djordjevic, Bojana; Vanderhyden, Barbara C. GREB1 is an estrogen receptor-regulated tumour promoter that is frequently expressed in ovarian cancer. Oncogene. 2018;37(44):5873-5886.  PubMed
Laviolette, Laura A; Hodgkinson, Kendra M; Minhas, Neha; Perez-Iratxeta, Carol; Vanderhyden, Barbara C. 17β-estradiol upregulates GREB1 and accelerates ovarian tumor progression in vivo. International Journal Of Cancer. 2014;135(5):1072-84.  PubMed
Zhao, Yuechao; Laws, Mary J; Guillen, Valeria Sanabria; Ziegler, Yvonne; Min, Jian; Sharma, Abhishek; Kim, Sung Hoon; Chu, David; Park, Ben Ho; Oesterreich, Steffi; Mao, Chengjian; Shapiro, David J; Nettles, Kendall W; Katzenellenbogen, John A; Katzenellenbogen, Benita S. Structurally Novel Antiestrogens Elicit Differential Responses from Constitutively Active Mutant Estrogen Receptors in Breast Cancer Cells and Tumors. Cancer Research. 2017;77(20):5602-5613.  PubMed