Anti GREB1 pAb (ATL-HPA024616)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024616-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GREB1
Alternative Gene Name: KIAA0575
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036523: 85%, ENSRNOG00000024651: 85%
Entrez Gene ID: 9687
Uniprot ID: Q4ZG55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EGDIDILLDKFHQENQGHISSSLAASSVTKAASLDVSGTPVCTSYNLEPHSIRPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFLICIP |
Gene Sequence | EGDIDILLDKFHQENQGHISSSLAASSVTKAASLDVSGTPVCTSYNLEPHSIRPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFLICIP |
Gene ID - Mouse | ENSMUSG00000036523 |
Gene ID - Rat | ENSRNOG00000024651 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GREB1 pAb (ATL-HPA024616) | |
Datasheet | Anti GREB1 pAb (ATL-HPA024616) Datasheet (External Link) |
Vendor Page | Anti GREB1 pAb (ATL-HPA024616) at Atlas Antibodies |
Documents & Links for Anti GREB1 pAb (ATL-HPA024616) | |
Datasheet | Anti GREB1 pAb (ATL-HPA024616) Datasheet (External Link) |
Vendor Page | Anti GREB1 pAb (ATL-HPA024616) |
Citations for Anti GREB1 pAb (ATL-HPA024616) – 3 Found |
Hodgkinson, Kendra; Forrest, Laura A; Vuong, Nhung; Garson, Kenneth; Djordjevic, Bojana; Vanderhyden, Barbara C. GREB1 is an estrogen receptor-regulated tumour promoter that is frequently expressed in ovarian cancer. Oncogene. 2018;37(44):5873-5886. PubMed |
Laviolette, Laura A; Hodgkinson, Kendra M; Minhas, Neha; Perez-Iratxeta, Carol; Vanderhyden, Barbara C. 17β-estradiol upregulates GREB1 and accelerates ovarian tumor progression in vivo. International Journal Of Cancer. 2014;135(5):1072-84. PubMed |
Zhao, Yuechao; Laws, Mary J; Guillen, Valeria Sanabria; Ziegler, Yvonne; Min, Jian; Sharma, Abhishek; Kim, Sung Hoon; Chu, David; Park, Ben Ho; Oesterreich, Steffi; Mao, Chengjian; Shapiro, David J; Nettles, Kendall W; Katzenellenbogen, John A; Katzenellenbogen, Benita S. Structurally Novel Antiestrogens Elicit Differential Responses from Constitutively Active Mutant Estrogen Receptors in Breast Cancer Cells and Tumors. Cancer Research. 2017;77(20):5602-5613. PubMed |