Anti GRB2 pAb (ATL-HPA030749 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA030749-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: growth factor receptor-bound protein 2
Gene Name: GRB2
Alternative Gene Name: NCKAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059923: 98%, ENSRNOG00000003990: 100%
Entrez Gene ID: 2885
Uniprot ID: P62993
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
Gene Sequence KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
Gene ID - Mouse ENSMUSG00000059923
Gene ID - Rat ENSRNOG00000003990
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRB2 pAb (ATL-HPA030749 w/enhanced validation)
Datasheet Anti GRB2 pAb (ATL-HPA030749 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRB2 pAb (ATL-HPA030749 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GRB2 pAb (ATL-HPA030749 w/enhanced validation)
Datasheet Anti GRB2 pAb (ATL-HPA030749 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GRB2 pAb (ATL-HPA030749 w/enhanced validation)