Anti GRB2 pAb (ATL-HPA030749 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA030749-25

• 
• 

Protein Description: growth factor receptor-bound protein 2
Gene Name: GRB2
Alternative Gene Name: NCKAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059923: 98%, ENSRNOG00000003990: 100%
Entrez Gene ID: 2885
Uniprot ID: P62993
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
• Gene Sequence: KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
• Gene ID - Mouse: ENSMUSG00000059923
• Gene ID - Rat: ENSRNOG00000003990
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.