Anti GRB14 pAb (ATL-HPA035053)

Atlas Antibodies

SKU:
ATL-HPA035053-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts, Leydig cells were strongly stained.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: growth factor receptor-bound protein 14
Gene Name: GRB14
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026888: 88%, ENSRNOG00000052498: 81%
Entrez Gene ID: 2888
Uniprot ID: Q14449
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIE
Gene Sequence PELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIE
Gene ID - Mouse ENSMUSG00000026888
Gene ID - Rat ENSRNOG00000052498
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GRB14 pAb (ATL-HPA035053)
Datasheet Anti GRB14 pAb (ATL-HPA035053) Datasheet (External Link)
Vendor Page Anti GRB14 pAb (ATL-HPA035053) at Atlas Antibodies

Documents & Links for Anti GRB14 pAb (ATL-HPA035053)
Datasheet Anti GRB14 pAb (ATL-HPA035053) Datasheet (External Link)
Vendor Page Anti GRB14 pAb (ATL-HPA035053)