Anti GRB10 pAb (ATL-HPA031818)

Atlas Antibodies

Catalog No.:
ATL-HPA031818-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: growth factor receptor-bound protein 10
Gene Name: GRB10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020176: 30%, ENSRNOG00000004290: 37%
Entrez Gene ID: 2887
Uniprot ID: Q13322
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVS
Gene Sequence LHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVS
Gene ID - Mouse ENSMUSG00000020176
Gene ID - Rat ENSRNOG00000004290
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRB10 pAb (ATL-HPA031818)
Datasheet Anti GRB10 pAb (ATL-HPA031818) Datasheet (External Link)
Vendor Page Anti GRB10 pAb (ATL-HPA031818) at Atlas Antibodies

Documents & Links for Anti GRB10 pAb (ATL-HPA031818)
Datasheet Anti GRB10 pAb (ATL-HPA031818) Datasheet (External Link)
Vendor Page Anti GRB10 pAb (ATL-HPA031818)