Anti GRASP pAb (ATL-HPA040664)

Atlas Antibodies

Catalog No.:
ATL-HPA040664-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein
Gene Name: GRASP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000531: 100%, ENSRNOG00000007346: 100%
Entrez Gene ID: 160622
Uniprot ID: Q7Z6J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGTSIRKAELEARLQYLKQTLYEKWG
Gene Sequence VEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGTSIRKAELEARLQYLKQTLYEKWG
Gene ID - Mouse ENSMUSG00000000531
Gene ID - Rat ENSRNOG00000007346
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRASP pAb (ATL-HPA040664)
Datasheet Anti GRASP pAb (ATL-HPA040664) Datasheet (External Link)
Vendor Page Anti GRASP pAb (ATL-HPA040664) at Atlas Antibodies

Documents & Links for Anti GRASP pAb (ATL-HPA040664)
Datasheet Anti GRASP pAb (ATL-HPA040664) Datasheet (External Link)
Vendor Page Anti GRASP pAb (ATL-HPA040664)