Anti GRAMD1C pAb (ATL-HPA012316)

Atlas Antibodies

Catalog No.: ATL-HPA012316-25

Protein Description: GRAM domain containing 1C
Gene Name: GRAMD1C
Alternative Gene Name: DKFZp434C0328
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036292: 80%, ENSRNOG00000053406: 79%
Entrez Gene ID: 54762
Uniprot ID: Q8IYS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLLIEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKG
• Gene Sequence: VSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLLIEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKG
• Gene ID - Mouse: ENSMUSG00000036292
• Gene ID - Rat: ENSRNOG00000053406
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.