Anti GRAMD1C pAb (ATL-HPA012316)

Atlas Antibodies

Catalog No.:
ATL-HPA012316-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: GRAM domain containing 1C
Gene Name: GRAMD1C
Alternative Gene Name: DKFZp434C0328
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036292: 80%, ENSRNOG00000053406: 79%
Entrez Gene ID: 54762
Uniprot ID: Q8IYS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLLIEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKG
Gene Sequence VSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLLIEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKG
Gene ID - Mouse ENSMUSG00000036292
Gene ID - Rat ENSRNOG00000053406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GRAMD1C pAb (ATL-HPA012316)
Datasheet Anti GRAMD1C pAb (ATL-HPA012316) Datasheet (External Link)
Vendor Page Anti GRAMD1C pAb (ATL-HPA012316) at Atlas Antibodies

Documents & Links for Anti GRAMD1C pAb (ATL-HPA012316)
Datasheet Anti GRAMD1C pAb (ATL-HPA012316) Datasheet (External Link)
Vendor Page Anti GRAMD1C pAb (ATL-HPA012316)