Anti GPX8 pAb (ATL-HPA036720 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036720-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GPX8
Alternative Gene Name: EPLA847, UNQ847
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021760: 70%, ENSRNOG00000010461: 70%
Entrez Gene ID: 493869
Uniprot ID: Q8TED1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVII |
| Gene Sequence | WKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVII |
| Gene ID - Mouse | ENSMUSG00000021760 |
| Gene ID - Rat | ENSRNOG00000010461 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GPX8 pAb (ATL-HPA036720 w/enhanced validation) | |
| Datasheet | Anti GPX8 pAb (ATL-HPA036720 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GPX8 pAb (ATL-HPA036720 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GPX8 pAb (ATL-HPA036720 w/enhanced validation) | |
| Datasheet | Anti GPX8 pAb (ATL-HPA036720 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GPX8 pAb (ATL-HPA036720 w/enhanced validation) |
| Citations for Anti GPX8 pAb (ATL-HPA036720 w/enhanced validation) – 2 Found |
| Khatib, Anees; Solaimuthu, Balakrishnan; Ben Yosef, Michal; Abu Rmaileh, Areej; Tanna, Mayur; Oren, Gidi; Schlesinger Frisch, Michal; Axelrod, Jonathan H; Lichtenstein, Michal; Shaul, Yoav D. The glutathione peroxidase 8 (GPX8)/IL-6/STAT3 axis is essential in maintaining an aggressive breast cancer phenotype. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2020;117(35):21420-21431. PubMed |
| Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094. PubMed |