Anti GPX8 pAb (ATL-HPA036720 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036720-25

• 
• 
• 

Protein Description: glutathione peroxidase 8 (putative)
Gene Name: GPX8
Alternative Gene Name: EPLA847, UNQ847
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021760: 70%, ENSRNOG00000010461: 70%
Entrez Gene ID: 493869
Uniprot ID: Q8TED1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVII
• Gene Sequence: WKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVII
• Gene ID - Mouse: ENSMUSG00000021760
• Gene ID - Rat: ENSRNOG00000010461
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GPX8 pAb (ATL-HPA036720 w/enhanced validation) – 2 Found

Khatib, Anees; Solaimuthu, Balakrishnan; Ben Yosef, Michal; Abu Rmaileh, Areej; Tanna, Mayur; Oren, Gidi; Schlesinger Frisch, Michal; Axelrod, Jonathan H; Lichtenstein, Michal; Shaul, Yoav D. The glutathione peroxidase 8 (GPX8)/IL-6/STAT3 axis is essential in maintaining an aggressive breast cancer phenotype. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2020;117(35):21420-21431. 

Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094.