Anti GPT pAb (ATL-HPA031059 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA031059-25

• 
• 

Protein Description: glutamic-pyruvate transaminase (alanine aminotransferase)
Gene Name: GPT
Alternative Gene Name: ALT1, GPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022546: 85%, ENSRNOG00000033915: 85%
Entrez Gene ID: 2875
Uniprot ID: P24298
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT
• Gene Sequence: MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT
• Gene ID - Mouse: ENSMUSG00000022546
• Gene ID - Rat: ENSRNOG00000033915
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.