Anti GPSM2 pAb (ATL-HPA008408)

Atlas Antibodies

SKU:
ATL-HPA008408-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G-protein signaling modulator 2
Gene Name: GPSM2
Alternative Gene Name: DFNB82, LGN, Pins
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027883: 78%, ENSRNOG00000012149: 75%
Entrez Gene ID: 29899
Uniprot ID: P81274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFD
Gene Sequence FQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFD
Gene ID - Mouse ENSMUSG00000027883
Gene ID - Rat ENSRNOG00000012149
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPSM2 pAb (ATL-HPA008408)
Datasheet Anti GPSM2 pAb (ATL-HPA008408) Datasheet (External Link)
Vendor Page Anti GPSM2 pAb (ATL-HPA008408) at Atlas Antibodies

Documents & Links for Anti GPSM2 pAb (ATL-HPA008408)
Datasheet Anti GPSM2 pAb (ATL-HPA008408) Datasheet (External Link)
Vendor Page Anti GPSM2 pAb (ATL-HPA008408)