Anti GPSM1 pAb (ATL-HPA042199)

Atlas Antibodies

SKU:
ATL-HPA042199-25
  • Immunohistochemical staining of human stomach, lower shows distinct cytoplasmic and nuclear membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G-protein signaling modulator 1
Gene Name: GPSM1
Alternative Gene Name: AGS3, DKFZP727I051
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026930: 90%, ENSRNOG00000018666: 91%
Entrez Gene ID: 26086
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPAASEKPDLAGYEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRK
Gene Sequence SPAASEKPDLAGYEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRK
Gene ID - Mouse ENSMUSG00000026930
Gene ID - Rat ENSRNOG00000018666
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPSM1 pAb (ATL-HPA042199)
Datasheet Anti GPSM1 pAb (ATL-HPA042199) Datasheet (External Link)
Vendor Page Anti GPSM1 pAb (ATL-HPA042199) at Atlas Antibodies

Documents & Links for Anti GPSM1 pAb (ATL-HPA042199)
Datasheet Anti GPSM1 pAb (ATL-HPA042199) Datasheet (External Link)
Vendor Page Anti GPSM1 pAb (ATL-HPA042199)