Anti GPRIN1 pAb (ATL-HPA036478)

Atlas Antibodies

Catalog No.:
ATL-HPA036478-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: G protein regulated inducer of neurite outgrowth 1
Gene Name: GPRIN1
Alternative Gene Name: GRIN1, KIAA1893
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069227: 45%, ENSRNOG00000020130: 29%
Entrez Gene ID: 114787
Uniprot ID: Q7Z2K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPT
Gene Sequence EPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPT
Gene ID - Mouse ENSMUSG00000069227
Gene ID - Rat ENSRNOG00000020130
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPRIN1 pAb (ATL-HPA036478)
Datasheet Anti GPRIN1 pAb (ATL-HPA036478) Datasheet (External Link)
Vendor Page Anti GPRIN1 pAb (ATL-HPA036478) at Atlas Antibodies

Documents & Links for Anti GPRIN1 pAb (ATL-HPA036478)
Datasheet Anti GPRIN1 pAb (ATL-HPA036478) Datasheet (External Link)
Vendor Page Anti GPRIN1 pAb (ATL-HPA036478)