Anti GPRIN1 pAb (ATL-HPA036478)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036478-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GPRIN1
Alternative Gene Name: GRIN1, KIAA1893
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069227: 45%, ENSRNOG00000020130: 29%
Entrez Gene ID: 114787
Uniprot ID: Q7Z2K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPT |
Gene Sequence | EPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPT |
Gene ID - Mouse | ENSMUSG00000069227 |
Gene ID - Rat | ENSRNOG00000020130 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GPRIN1 pAb (ATL-HPA036478) | |
Datasheet | Anti GPRIN1 pAb (ATL-HPA036478) Datasheet (External Link) |
Vendor Page | Anti GPRIN1 pAb (ATL-HPA036478) at Atlas Antibodies |
Documents & Links for Anti GPRIN1 pAb (ATL-HPA036478) | |
Datasheet | Anti GPRIN1 pAb (ATL-HPA036478) Datasheet (External Link) |
Vendor Page | Anti GPRIN1 pAb (ATL-HPA036478) |