Anti GPRIN1 pAb (ATL-HPA036478)

Atlas Antibodies

Catalog No.: ATL-HPA036478-100

Protein Description: G protein regulated inducer of neurite outgrowth 1
Gene Name: GPRIN1
Alternative Gene Name: GRIN1, KIAA1893
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069227: 45%, ENSRNOG00000020130: 29%
Entrez Gene ID: 114787
Uniprot ID: Q7Z2K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPT
• Gene Sequence: EPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPT
• Gene ID - Mouse: ENSMUSG00000069227
• Gene ID - Rat: ENSRNOG00000020130
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.