Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA015247-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor, class C, group 5, member B
Gene Name: GPRC5B
Alternative Gene Name: RAIG-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008734: 82%, ENSRNOG00000016013: 83%
Entrez Gene ID: 51704
Uniprot ID: Q9NZH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAP
Gene Sequence IHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAP
Gene ID - Mouse ENSMUSG00000008734
Gene ID - Rat ENSRNOG00000016013
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation)
Datasheet Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation)
Datasheet Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation)
Citations for Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation) – 1 Found
Zambrano, Sonia; Möller-Hackbarth, Katja; Li, Xidan; Rodriguez, Patricia Q; Charrin, Emmanuelle; Schwarz, Angelina; Nyström, Jenny; Wernerson, Annika Östman; Lal, Mark; Patrakka, Jaakko. GPRC5b Modulates Inflammatory Response in Glomerular Diseases via NF-κB Pathway. Journal Of The American Society Of Nephrology : Jasn. 2019;30(9):1573-1586.  PubMed