Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015247-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GPRC5B
Alternative Gene Name: RAIG-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008734: 82%, ENSRNOG00000016013: 83%
Entrez Gene ID: 51704
Uniprot ID: Q9NZH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAP |
| Gene Sequence | IHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAP |
| Gene ID - Mouse | ENSMUSG00000008734 |
| Gene ID - Rat | ENSRNOG00000016013 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation) | |
| Datasheet | Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation) | |
| Datasheet | Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation) |
| Citations for Anti GPRC5B pAb (ATL-HPA015247 w/enhanced validation) – 1 Found |
| Zambrano, Sonia; Möller-Hackbarth, Katja; Li, Xidan; Rodriguez, Patricia Q; Charrin, Emmanuelle; Schwarz, Angelina; Nyström, Jenny; Wernerson, Annika Östman; Lal, Mark; Patrakka, Jaakko. GPRC5b Modulates Inflammatory Response in Glomerular Diseases via NF-κB Pathway. Journal Of The American Society Of Nephrology : Jasn. 2019;30(9):1573-1586. PubMed |