Anti GPRC5A pAb (ATL-HPA046526)

Atlas Antibodies

Catalog No.:
ATL-HPA046526-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor, class C, group 5, member A
Gene Name: GPRC5A
Alternative Gene Name: PEIG-1, RAI3, RAIG1, TIG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046733: 55%, ENSRNOG00000008412: 58%
Entrez Gene ID: 9052
Uniprot ID: Q8NFJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MATTVPDGCRNGLKSKYYRLCDKAEAWGIVL
Gene Sequence MATTVPDGCRNGLKSKYYRLCDKAEAWGIVL
Gene ID - Mouse ENSMUSG00000046733
Gene ID - Rat ENSRNOG00000008412
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPRC5A pAb (ATL-HPA046526)
Datasheet Anti GPRC5A pAb (ATL-HPA046526) Datasheet (External Link)
Vendor Page Anti GPRC5A pAb (ATL-HPA046526) at Atlas Antibodies

Documents & Links for Anti GPRC5A pAb (ATL-HPA046526)
Datasheet Anti GPRC5A pAb (ATL-HPA046526) Datasheet (External Link)
Vendor Page Anti GPRC5A pAb (ATL-HPA046526)