Anti GPRC5A pAb (ATL-HPA007928 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007928-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GPRC5A
Alternative Gene Name: GPCR5A, RAI3, RAIG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046733: 82%, ENSRNOG00000008412: 81%
Entrez Gene ID: 9052
Uniprot ID: Q8NFJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR |
Gene Sequence | LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR |
Gene ID - Mouse | ENSMUSG00000046733 |
Gene ID - Rat | ENSRNOG00000008412 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GPRC5A pAb (ATL-HPA007928 w/enhanced validation) | |
Datasheet | Anti GPRC5A pAb (ATL-HPA007928 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GPRC5A pAb (ATL-HPA007928 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GPRC5A pAb (ATL-HPA007928 w/enhanced validation) | |
Datasheet | Anti GPRC5A pAb (ATL-HPA007928 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GPRC5A pAb (ATL-HPA007928 w/enhanced validation) |
Citations for Anti GPRC5A pAb (ATL-HPA007928 w/enhanced validation) – 6 Found |
Bulanova, Daria R; Akimov, Yevhen A; Rokka, Anne; Laajala, Teemu D; Aittokallio, Tero; Kouvonen, Petri; Pellinen, Teijo; Kuznetsov, Sergey G. Orphan G protein-coupled receptor GPRC5A modulates integrin β1-mediated epithelial cell adhesion. Cell Adhesion & Migration. 2017;11(5-6):434-446. PubMed |
Insel, Paul A; Sriram, Krishna; Wiley, Shu Z; Wilderman, Andrea; Katakia, Trishna; McCann, Thalia; Yokouchi, Hiroshi; Zhang, Lingzhi; Corriden, Ross; Liu, Dongling; Feigin, Michael E; French, Randall P; Lowy, Andrew M; Murray, Fiona. GPCRomics: GPCR Expression in Cancer Cells and Tumors Identifies New, Potential Biomarkers and Therapeutic Targets. Frontiers In Pharmacology. 9( 29872392):431. PubMed |
Hong, Sung Pil; Chan, Thalia E; Lombardo, Ylenia; Corleone, Giacomo; Rotmensz, Nicole; Bravaccini, Sara; Rocca, Andrea; Pruneri, Giancarlo; McEwen, Kirsten R; Coombes, R Charles; Barozzi, Iros; Magnani, Luca. Single-cell transcriptomics reveals multi-step adaptations to endocrine therapy. Nature Communications. 2019;10(1):3840. PubMed |
Moyano-Galceran, Lidia; Pietilä, Elina A; Turunen, S Pauliina; Corvigno, Sara; Hjerpe, Elisabet; Bulanova, Daria; Joneborg, Ulrika; Alkasalias, Twana; Miki, Yuichiro; Yashiro, Masakazu; Chernenko, Anastasiya; Jukonen, Joonas; Singh, Madhurendra; Dahlstrand, Hanna; Carlson, Joseph W; Lehti, Kaisa. Adaptive RSK-EphA2-GPRC5A signaling switch triggers chemotherapy resistance in ovarian cancer. Embo Molecular Medicine. 2020;12(4):e11177. PubMed |
Richter, Lukas; Oberländer, Viktoria; Schmidt, Gudula. RhoA/C inhibits proliferation by inducing the synthesis of GPRC5A. Scientific Reports. 2020;10(1):12532. PubMed |
Wu, Rongrong; Högberg, Johan; Adner, Mikael; Ramos-Ramírez, Patricia; Stenius, Ulla; Zheng, Huiyuan. Crystalline silica particles cause rapid NLRP3-dependent mitochondrial depolarization and DNA damage in airway epithelial cells. Particle And Fibre Toxicology. 2020;17(1):39. PubMed |