Anti GPRC5A pAb (ATL-HPA007928 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA007928-25

• 
• 
• 

Protein Description: G protein-coupled receptor, class C, group 5, member A
Gene Name: GPRC5A
Alternative Gene Name: GPCR5A, RAI3, RAIG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046733: 82%, ENSRNOG00000008412: 81%
Entrez Gene ID: 9052
Uniprot ID: Q8NFJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR
• Gene Sequence: LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR
• Gene ID - Mouse: ENSMUSG00000046733
• Gene ID - Rat: ENSRNOG00000008412
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GPRC5A pAb (ATL-HPA007928 w/enhanced validation) – 6 Found

Bulanova, Daria R; Akimov, Yevhen A; Rokka, Anne; Laajala, Teemu D; Aittokallio, Tero; Kouvonen, Petri; Pellinen, Teijo; Kuznetsov, Sergey G. Orphan G protein-coupled receptor GPRC5A modulates integrin β1-mediated epithelial cell adhesion. Cell Adhesion & Migration. 2017;11(5-6):434-446. 

Insel, Paul A; Sriram, Krishna; Wiley, Shu Z; Wilderman, Andrea; Katakia, Trishna; McCann, Thalia; Yokouchi, Hiroshi; Zhang, Lingzhi; Corriden, Ross; Liu, Dongling; Feigin, Michael E; French, Randall P; Lowy, Andrew M; Murray, Fiona. GPCRomics: GPCR Expression in Cancer Cells and Tumors Identifies New, Potential Biomarkers and Therapeutic Targets. Frontiers In Pharmacology. 9( 29872392):431. 

Hong, Sung Pil; Chan, Thalia E; Lombardo, Ylenia; Corleone, Giacomo; Rotmensz, Nicole; Bravaccini, Sara; Rocca, Andrea; Pruneri, Giancarlo; McEwen, Kirsten R; Coombes, R Charles; Barozzi, Iros; Magnani, Luca. Single-cell transcriptomics reveals multi-step adaptations to endocrine therapy. Nature Communications. 2019;10(1):3840. 

Moyano-Galceran, Lidia; Pietilä, Elina A; Turunen, S Pauliina; Corvigno, Sara; Hjerpe, Elisabet; Bulanova, Daria; Joneborg, Ulrika; Alkasalias, Twana; Miki, Yuichiro; Yashiro, Masakazu; Chernenko, Anastasiya; Jukonen, Joonas; Singh, Madhurendra; Dahlstrand, Hanna; Carlson, Joseph W; Lehti, Kaisa. Adaptive RSK-EphA2-GPRC5A signaling switch triggers chemotherapy resistance in ovarian cancer. Embo Molecular Medicine. 2020;12(4):e11177. 

Richter, Lukas; Oberländer, Viktoria; Schmidt, Gudula. RhoA/C inhibits proliferation by inducing the synthesis of GPRC5A. Scientific Reports. 2020;10(1):12532. 

Wu, Rongrong; Högberg, Johan; Adner, Mikael; Ramos-Ramírez, Patricia; Stenius, Ulla; Zheng, Huiyuan. Crystalline silica particles cause rapid NLRP3-dependent mitochondrial depolarization and DNA damage in airway epithelial cells. Particle And Fibre Toxicology. 2020;17(1):39.