Anti GPRASP2 pAb (ATL-HPA017438 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA017438-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor associated sorting protein 2
Gene Name: GPRASP2
Alternative Gene Name: FLJ37327, GASP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072966: 66%, ENSRNOG00000037658: 72%
Entrez Gene ID: 114928
Uniprot ID: Q96D09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPLVVRPKVRTQATTGARPKTETKSVPAARPKTEAQAMSGARPKTEVQVMGGARPKTEAQGITGARPKTDARAVGGARSKTDAKAIPGARPKDEAQAWAQSEFGTEAVSQAEGVSQTNA
Gene Sequence VPLVVRPKVRTQATTGARPKTETKSVPAARPKTEAQAMSGARPKTEVQVMGGARPKTEAQGITGARPKTDARAVGGARSKTDAKAIPGARPKDEAQAWAQSEFGTEAVSQAEGVSQTNA
Gene ID - Mouse ENSMUSG00000072966
Gene ID - Rat ENSRNOG00000037658
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPRASP2 pAb (ATL-HPA017438 w/enhanced validation)
Datasheet Anti GPRASP2 pAb (ATL-HPA017438 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPRASP2 pAb (ATL-HPA017438 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GPRASP2 pAb (ATL-HPA017438 w/enhanced validation)
Datasheet Anti GPRASP2 pAb (ATL-HPA017438 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPRASP2 pAb (ATL-HPA017438 w/enhanced validation)
Citations for Anti GPRASP2 pAb (ATL-HPA017438 w/enhanced validation) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed