Anti GPRASP1 pAb (ATL-HPA000161)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000161-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GPRASP1
Alternative Gene Name: GASP, GASP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043384: 54%, ENSRNOG00000049985: 56%
Entrez Gene ID: 9737
Uniprot ID: Q5JY77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VEACVEGDVNSKSSLEDKEEAMIPCFGAKEEVSMKHGTGVRCRFMAGAEETNNKSCFWAEKEPCMYPAGGGSWKSRPEEEEDIVNSWFWSRKYTKPEAIIGSWLWATEESNIDGTGEKAKLLTEE |
Gene Sequence | VEACVEGDVNSKSSLEDKEEAMIPCFGAKEEVSMKHGTGVRCRFMAGAEETNNKSCFWAEKEPCMYPAGGGSWKSRPEEEEDIVNSWFWSRKYTKPEAIIGSWLWATEESNIDGTGEKAKLLTEE |
Gene ID - Mouse | ENSMUSG00000043384 |
Gene ID - Rat | ENSRNOG00000049985 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GPRASP1 pAb (ATL-HPA000161) | |
Datasheet | Anti GPRASP1 pAb (ATL-HPA000161) Datasheet (External Link) |
Vendor Page | Anti GPRASP1 pAb (ATL-HPA000161) at Atlas Antibodies |
Documents & Links for Anti GPRASP1 pAb (ATL-HPA000161) | |
Datasheet | Anti GPRASP1 pAb (ATL-HPA000161) Datasheet (External Link) |
Vendor Page | Anti GPRASP1 pAb (ATL-HPA000161) |
Citations for Anti GPRASP1 pAb (ATL-HPA000161) – 2 Found |
Kuramoto, Kenta; Wang, Nan; Fan, Yuying; Zhang, Weiran; Schoenen, Frank J; Frankowski, Kevin J; Marugan, Juan; Zhou, Yifa; Huang, Sui; He, Congcong. Autophagy activation by novel inducers prevents BECN2-mediated drug tolerance to cannabinoids. Autophagy. 2016;12(9):1460-71. PubMed |
Kim, Yoon-Jin; Kong, Qingyao; Yamamoto, Soh; Kuramoto, Kenta; Huang, Mei; Wang, Nan; Hong, Jung Hwa; Xiao, Tong; Levine, Beth; Qiu, Xianxiu; Zhao, Yanxiang; Miller, Richard J; Dong, Hongxin; Meltzer, Herbert Y; Xu, Ming; He, Congcong. An autophagy-related protein Becn2 regulates cocaine reward behaviors in the dopaminergic system. Science Advances. 2021;7(8) PubMed |