Anti GPR61 pAb (ATL-HPA026088)

Atlas Antibodies

SKU:
ATL-HPA026088-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 61
Gene Name: GPR61
Alternative Gene Name: BALGR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046793: 91%, ENSRNOG00000019738: 92%
Entrez Gene ID: 83873
Uniprot ID: Q9BZJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFVCFFKPAPEEELRLPSREGSIEENFLQFLQGTGCPSESWVSRPLPSPKQEPPAVDFRIPGQIAEETSEFLEQQLTSDIIMSDSYLRPAASPRLES
Gene Sequence QFVCFFKPAPEEELRLPSREGSIEENFLQFLQGTGCPSESWVSRPLPSPKQEPPAVDFRIPGQIAEETSEFLEQQLTSDIIMSDSYLRPAASPRLES
Gene ID - Mouse ENSMUSG00000046793
Gene ID - Rat ENSRNOG00000019738
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPR61 pAb (ATL-HPA026088)
Datasheet Anti GPR61 pAb (ATL-HPA026088) Datasheet (External Link)
Vendor Page Anti GPR61 pAb (ATL-HPA026088) at Atlas Antibodies

Documents & Links for Anti GPR61 pAb (ATL-HPA026088)
Datasheet Anti GPR61 pAb (ATL-HPA026088) Datasheet (External Link)
Vendor Page Anti GPR61 pAb (ATL-HPA026088)