Anti GPR61 pAb (ATL-HPA007326)

Atlas Antibodies

Catalog No.:
ATL-HPA007326-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 61
Gene Name: GPR61
Alternative Gene Name: BALGR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046793: 98%, ENSRNOG00000019738: 98%
Entrez Gene ID: 83873
Uniprot ID: Q9BZJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SMFRVARVAAMQHGPLPTWMETPRQRSESLSSRSTMVTSSGAPQTTPHRTFGGGKAAVV
Gene Sequence SMFRVARVAAMQHGPLPTWMETPRQRSESLSSRSTMVTSSGAPQTTPHRTFGGGKAAVV
Gene ID - Mouse ENSMUSG00000046793
Gene ID - Rat ENSRNOG00000019738
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR61 pAb (ATL-HPA007326)
Datasheet Anti GPR61 pAb (ATL-HPA007326) Datasheet (External Link)
Vendor Page Anti GPR61 pAb (ATL-HPA007326) at Atlas Antibodies

Documents & Links for Anti GPR61 pAb (ATL-HPA007326)
Datasheet Anti GPR61 pAb (ATL-HPA007326) Datasheet (External Link)
Vendor Page Anti GPR61 pAb (ATL-HPA007326)