Anti GPR19 pAb (ATL-HPA013955)

Atlas Antibodies

Catalog No.:
ATL-HPA013955-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 19
Gene Name: GPR19
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032641: 60%, ENSRNOG00000007126: 60%
Entrez Gene ID: 2842
Uniprot ID: Q15760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTD
Gene Sequence RMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTD
Gene ID - Mouse ENSMUSG00000032641
Gene ID - Rat ENSRNOG00000007126
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR19 pAb (ATL-HPA013955)
Datasheet Anti GPR19 pAb (ATL-HPA013955) Datasheet (External Link)
Vendor Page Anti GPR19 pAb (ATL-HPA013955) at Atlas Antibodies

Documents & Links for Anti GPR19 pAb (ATL-HPA013955)
Datasheet Anti GPR19 pAb (ATL-HPA013955) Datasheet (External Link)
Vendor Page Anti GPR19 pAb (ATL-HPA013955)