Anti GPR182 pAb (ATL-HPA027037 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA027037-25
  • Immunohistochemistry analysis in human spleen and cerebral cortex tissues using Anti-GPR182 antibody. Corresponding GPR182 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 182
Gene Name: GPR182
Alternative Gene Name: ADMR, AM-R, G10D, hrhAMR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058396: 54%, ENSRNOG00000004311: 54%
Entrez Gene ID: 11318
Uniprot ID: O15218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Gene Sequence LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Gene ID - Mouse ENSMUSG00000058396
Gene ID - Rat ENSRNOG00000004311
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GPR182 pAb (ATL-HPA027037 w/enhanced validation)
Datasheet Anti GPR182 pAb (ATL-HPA027037 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPR182 pAb (ATL-HPA027037 w/enhanced validation)