Anti GPR176 pAb (ATL-HPA039979)

Atlas Antibodies

Catalog No.:
ATL-HPA039979-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 176
Gene Name: GPR176
Alternative Gene Name: Gm1012
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040133: 85%, ENSRNOG00000005971: 89%
Entrez Gene ID: 11245
Uniprot ID: Q14439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPLSTVDSVSQVAPAAPVEPETFPDKYSLQFGFGPFELPPQWLSETRNSKKRLLPPLGNTPEELIQTKVPKVGRVERKMSRNNKV
Gene Sequence PPLSTVDSVSQVAPAAPVEPETFPDKYSLQFGFGPFELPPQWLSETRNSKKRLLPPLGNTPEELIQTKVPKVGRVERKMSRNNKV
Gene ID - Mouse ENSMUSG00000040133
Gene ID - Rat ENSRNOG00000005971
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR176 pAb (ATL-HPA039979)
Datasheet Anti GPR176 pAb (ATL-HPA039979) Datasheet (External Link)
Vendor Page Anti GPR176 pAb (ATL-HPA039979) at Atlas Antibodies

Documents & Links for Anti GPR176 pAb (ATL-HPA039979)
Datasheet Anti GPR176 pAb (ATL-HPA039979) Datasheet (External Link)
Vendor Page Anti GPR176 pAb (ATL-HPA039979)