Anti GPR176 pAb (ATL-HPA039943 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039943-25
  • Immunohistochemical staining of human caudate nucleus shows moderate positivity in neuropil.
  • Western blot analysis in human cell lines A-431 and MCF-7 using Anti-GPR176 antibody. Corresponding GPR176 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 176
Gene Name: GPR176
Alternative Gene Name: Gm1012
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040133: 84%, ENSRNOG00000005971: 78%
Entrez Gene ID: 11245
Uniprot ID: Q14439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KCLIGTLVQLHHRYSRRNVVSTGSGMAEASLEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFSTCLEGEQGPQFA
Gene Sequence KCLIGTLVQLHHRYSRRNVVSTGSGMAEASLEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFSTCLEGEQGPQFA
Gene ID - Mouse ENSMUSG00000040133
Gene ID - Rat ENSRNOG00000005971
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GPR176 pAb (ATL-HPA039943 w/enhanced validation)
Datasheet Anti GPR176 pAb (ATL-HPA039943 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPR176 pAb (ATL-HPA039943 w/enhanced validation)