Anti GPR161 pAb (ATL-HPA015576)

Atlas Antibodies

Catalog No.:
ATL-HPA015576-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 161
Gene Name: GPR161
Alternative Gene Name: RE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040836: 93%, ENSRNOG00000003073: 92%
Entrez Gene ID: 23432
Uniprot ID: Q8N6U8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLA
Gene Sequence MLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLA
Gene ID - Mouse ENSMUSG00000040836
Gene ID - Rat ENSRNOG00000003073
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR161 pAb (ATL-HPA015576)
Datasheet Anti GPR161 pAb (ATL-HPA015576) Datasheet (External Link)
Vendor Page Anti GPR161 pAb (ATL-HPA015576) at Atlas Antibodies

Documents & Links for Anti GPR161 pAb (ATL-HPA015576)
Datasheet Anti GPR161 pAb (ATL-HPA015576) Datasheet (External Link)
Vendor Page Anti GPR161 pAb (ATL-HPA015576)