Anti GPR150 pAb (ATL-HPA026635)

Atlas Antibodies

SKU:
ATL-HPA026635-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in molecular layer.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 150
Gene Name: GPR150
Alternative Gene Name: PGR11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045509: 69%, ENSRNOG00000026944: 73%
Entrez Gene ID: 285601
Uniprot ID: Q8NGU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDCRLRRQLRKRLGSLCCAPQGGAEDEEGPRGHQALYRQRWPHPHYHHARREPLDEGGLRPPPPRPRPLPCSCESAF
Gene Sequence GDCRLRRQLRKRLGSLCCAPQGGAEDEEGPRGHQALYRQRWPHPHYHHARREPLDEGGLRPPPPRPRPLPCSCESAF
Gene ID - Mouse ENSMUSG00000045509
Gene ID - Rat ENSRNOG00000026944
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPR150 pAb (ATL-HPA026635)
Datasheet Anti GPR150 pAb (ATL-HPA026635) Datasheet (External Link)
Vendor Page Anti GPR150 pAb (ATL-HPA026635) at Atlas Antibodies

Documents & Links for Anti GPR150 pAb (ATL-HPA026635)
Datasheet Anti GPR150 pAb (ATL-HPA026635) Datasheet (External Link)
Vendor Page Anti GPR150 pAb (ATL-HPA026635)