Anti GPR139 pAb (ATL-HPA046596)

Atlas Antibodies

Catalog No.:
ATL-HPA046596-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 139
Gene Name: GPR139
Alternative Gene Name: PGR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066197: 98%, ENSRNOG00000023863: 98%
Entrez Gene ID: 124274
Uniprot ID: Q6DWJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDK
Gene Sequence ISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDK
Gene ID - Mouse ENSMUSG00000066197
Gene ID - Rat ENSRNOG00000023863
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR139 pAb (ATL-HPA046596)
Datasheet Anti GPR139 pAb (ATL-HPA046596) Datasheet (External Link)
Vendor Page Anti GPR139 pAb (ATL-HPA046596) at Atlas Antibodies

Documents & Links for Anti GPR139 pAb (ATL-HPA046596)
Datasheet Anti GPR139 pAb (ATL-HPA046596) Datasheet (External Link)
Vendor Page Anti GPR139 pAb (ATL-HPA046596)