Anti GPR137C pAb (ATL-HPA030763)

Atlas Antibodies

SKU:
ATL-HPA030763-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 137C
Gene Name: GPR137C
Alternative Gene Name: DKFZp762F0713, TM7SF1L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049092: 88%, ENSRNOG00000026328: 88%
Entrez Gene ID: 283554
Uniprot ID: Q8N3F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAP
Gene Sequence RAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAP
Gene ID - Mouse ENSMUSG00000049092
Gene ID - Rat ENSRNOG00000026328
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPR137C pAb (ATL-HPA030763)
Datasheet Anti GPR137C pAb (ATL-HPA030763) Datasheet (External Link)
Vendor Page Anti GPR137C pAb (ATL-HPA030763) at Atlas Antibodies

Documents & Links for Anti GPR137C pAb (ATL-HPA030763)
Datasheet Anti GPR137C pAb (ATL-HPA030763) Datasheet (External Link)
Vendor Page Anti GPR137C pAb (ATL-HPA030763)