Anti GPR132 pAb (ATL-HPA029695)

Atlas Antibodies

SKU:
ATL-HPA029695-25
  • Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in a subset of non-germinal center cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 132
Gene Name: GPR132
Alternative Gene Name: G2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035429: 36%, ENSRNOG00000013914: 42%
Entrez Gene ID: 29933
Uniprot ID: Q9UNW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRI
Gene Sequence NGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRI
Gene ID - Mouse ENSMUSG00000035429
Gene ID - Rat ENSRNOG00000013914
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPR132 pAb (ATL-HPA029695)
Datasheet Anti GPR132 pAb (ATL-HPA029695) Datasheet (External Link)
Vendor Page Anti GPR132 pAb (ATL-HPA029695) at Atlas Antibodies

Documents & Links for Anti GPR132 pAb (ATL-HPA029695)
Datasheet Anti GPR132 pAb (ATL-HPA029695) Datasheet (External Link)
Vendor Page Anti GPR132 pAb (ATL-HPA029695)