Anti GPR132 pAb (ATL-HPA029695)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029695-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GPR132
Alternative Gene Name: G2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035429: 36%, ENSRNOG00000013914: 42%
Entrez Gene ID: 29933
Uniprot ID: Q9UNW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRI |
| Gene Sequence | NGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRI |
| Gene ID - Mouse | ENSMUSG00000035429 |
| Gene ID - Rat | ENSRNOG00000013914 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GPR132 pAb (ATL-HPA029695) | |
| Datasheet | Anti GPR132 pAb (ATL-HPA029695) Datasheet (External Link) |
| Vendor Page | Anti GPR132 pAb (ATL-HPA029695) at Atlas Antibodies |
| Documents & Links for Anti GPR132 pAb (ATL-HPA029695) | |
| Datasheet | Anti GPR132 pAb (ATL-HPA029695) Datasheet (External Link) |
| Vendor Page | Anti GPR132 pAb (ATL-HPA029695) |