Anti GPR132 pAb (ATL-HPA029694)
Atlas Antibodies
- SKU:
- ATL-HPA029694-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GPR132
Alternative Gene Name: G2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021298: 54%, ENSRNOG00000013914: 54%
Entrez Gene ID: 29933
Uniprot ID: Q9UNW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEE |
Gene Sequence | HSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEE |
Gene ID - Mouse | ENSMUSG00000021298 |
Gene ID - Rat | ENSRNOG00000013914 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GPR132 pAb (ATL-HPA029694) | |
Datasheet | Anti GPR132 pAb (ATL-HPA029694) Datasheet (External Link) |
Vendor Page | Anti GPR132 pAb (ATL-HPA029694) at Atlas Antibodies |
Documents & Links for Anti GPR132 pAb (ATL-HPA029694) | |
Datasheet | Anti GPR132 pAb (ATL-HPA029694) Datasheet (External Link) |
Vendor Page | Anti GPR132 pAb (ATL-HPA029694) |