Anti GPR132 pAb (ATL-HPA029694)

Atlas Antibodies

Catalog No.:
ATL-HPA029694-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 132
Gene Name: GPR132
Alternative Gene Name: G2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021298: 54%, ENSRNOG00000013914: 54%
Entrez Gene ID: 29933
Uniprot ID: Q9UNW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEE
Gene Sequence HSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEE
Gene ID - Mouse ENSMUSG00000021298
Gene ID - Rat ENSRNOG00000013914
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPR132 pAb (ATL-HPA029694)
Datasheet Anti GPR132 pAb (ATL-HPA029694) Datasheet (External Link)
Vendor Page Anti GPR132 pAb (ATL-HPA029694) at Atlas Antibodies

Documents & Links for Anti GPR132 pAb (ATL-HPA029694)
Datasheet Anti GPR132 pAb (ATL-HPA029694) Datasheet (External Link)
Vendor Page Anti GPR132 pAb (ATL-HPA029694)