Anti GPR108 pAb (ATL-HPA041924)

Atlas Antibodies

SKU:
ATL-HPA041924-25
  • Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G protein-coupled receptor 108
Gene Name: GPR108
Alternative Gene Name: LUSTR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005823: 70%, ENSRNOG00000046128: 72%
Entrez Gene ID: 56927
Uniprot ID: Q9NPR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGFSLSRVRSGRVRSYSTRDFQDCPLQKNSSSFLVLFLINTKDLQVQVRKYGEQKTLFIFPGLLPEAPSKPGLPKPQATVPRKVDG
Gene Sequence VGFSLSRVRSGRVRSYSTRDFQDCPLQKNSSSFLVLFLINTKDLQVQVRKYGEQKTLFIFPGLLPEAPSKPGLPKPQATVPRKVDG
Gene ID - Mouse ENSMUSG00000005823
Gene ID - Rat ENSRNOG00000046128
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPR108 pAb (ATL-HPA041924)
Datasheet Anti GPR108 pAb (ATL-HPA041924) Datasheet (External Link)
Vendor Page Anti GPR108 pAb (ATL-HPA041924) at Atlas Antibodies

Documents & Links for Anti GPR108 pAb (ATL-HPA041924)
Datasheet Anti GPR108 pAb (ATL-HPA041924) Datasheet (External Link)
Vendor Page Anti GPR108 pAb (ATL-HPA041924)