Anti GPN1 pAb (ATL-HPA036793 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036793-25
  • Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
  • Western blot analysis using Anti-GPN1 antibody HPA036793 (A) shows similar pattern to independent antibody HPA036794 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: GPN-loop GTPase 1
Gene Name: GPN1
Alternative Gene Name: ATPBD1A, MBDIN, NTPBP, RPAP4, XAB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064037: 81%, ENSRNOG00000004941: 83%
Entrez Gene ID: 11321
Uniprot ID: Q9HCN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK
Gene Sequence ALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK
Gene ID - Mouse ENSMUSG00000064037
Gene ID - Rat ENSRNOG00000004941
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPN1 pAb (ATL-HPA036793 w/enhanced validation)
Datasheet Anti GPN1 pAb (ATL-HPA036793 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPN1 pAb (ATL-HPA036793 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GPN1 pAb (ATL-HPA036793 w/enhanced validation)
Datasheet Anti GPN1 pAb (ATL-HPA036793 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GPN1 pAb (ATL-HPA036793 w/enhanced validation)