Anti GPN1 pAb (ATL-HPA036793 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036793-25

• 
• 
• 

Protein Description: GPN-loop GTPase 1
Gene Name: GPN1
Alternative Gene Name: ATPBD1A, MBDIN, NTPBP, RPAP4, XAB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064037: 81%, ENSRNOG00000004941: 83%
Entrez Gene ID: 11321
Uniprot ID: Q9HCN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK
• Gene Sequence: ALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK
• Gene ID - Mouse: ENSMUSG00000064037
• Gene ID - Rat: ENSRNOG00000004941
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.