Anti GPM6B pAb (ATL-HPA002913)
Atlas Antibodies
- SKU:
- ATL-HPA002913-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GPM6B
Alternative Gene Name: M6B, MGC17150, MGC54284
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031342: 96%, ENSRNOG00000004613: 96%
Entrez Gene ID: 2824
Uniprot ID: Q13491
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH |
| Gene Sequence | AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH |
| Gene ID - Mouse | ENSMUSG00000031342 |
| Gene ID - Rat | ENSRNOG00000004613 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GPM6B pAb (ATL-HPA002913) | |
| Datasheet | Anti GPM6B pAb (ATL-HPA002913) Datasheet (External Link) |
| Vendor Page | Anti GPM6B pAb (ATL-HPA002913) at Atlas Antibodies |
| Documents & Links for Anti GPM6B pAb (ATL-HPA002913) | |
| Datasheet | Anti GPM6B pAb (ATL-HPA002913) Datasheet (External Link) |
| Vendor Page | Anti GPM6B pAb (ATL-HPA002913) |
| Citations for Anti GPM6B pAb (ATL-HPA002913) – 1 Found |
| Kammula, Ellen C; Mötter, Jessica; Gorgels, Alexandra; Jonas, Esther; Hoffmann, Silke; Willbold, Dieter. Brain transcriptome-wide screen for HIV-1 Nef protein interaction partners reveals various membrane-associated proteins. Plos One. 7(12):e51578. PubMed |