Anti GPM6B pAb (ATL-HPA002913)

Atlas Antibodies

Catalog No.:
ATL-HPA002913-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glycoprotein M6B
Gene Name: GPM6B
Alternative Gene Name: M6B, MGC17150, MGC54284
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031342: 96%, ENSRNOG00000004613: 96%
Entrez Gene ID: 2824
Uniprot ID: Q13491
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
Gene Sequence AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
Gene ID - Mouse ENSMUSG00000031342
Gene ID - Rat ENSRNOG00000004613
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPM6B pAb (ATL-HPA002913)
Datasheet Anti GPM6B pAb (ATL-HPA002913) Datasheet (External Link)
Vendor Page Anti GPM6B pAb (ATL-HPA002913) at Atlas Antibodies

Documents & Links for Anti GPM6B pAb (ATL-HPA002913)
Datasheet Anti GPM6B pAb (ATL-HPA002913) Datasheet (External Link)
Vendor Page Anti GPM6B pAb (ATL-HPA002913)
Citations for Anti GPM6B pAb (ATL-HPA002913) – 1 Found
Kammula, Ellen C; Mötter, Jessica; Gorgels, Alexandra; Jonas, Esther; Hoffmann, Silke; Willbold, Dieter. Brain transcriptome-wide screen for HIV-1 Nef protein interaction partners reveals various membrane-associated proteins. Plos One. 7(12):e51578.  PubMed