Anti GPM6A pAb (ATL-HPA017338)

Atlas Antibodies

Catalog No.:
ATL-HPA017338-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glycoprotein M6A
Gene Name: GPM6A
Alternative Gene Name: GPM6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031517: 96%, ENSRNOG00000010731: 98%
Entrez Gene ID: 2823
Uniprot ID: P51674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELN
Gene Sequence YFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELN
Gene ID - Mouse ENSMUSG00000031517
Gene ID - Rat ENSRNOG00000010731
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPM6A pAb (ATL-HPA017338)
Datasheet Anti GPM6A pAb (ATL-HPA017338) Datasheet (External Link)
Vendor Page Anti GPM6A pAb (ATL-HPA017338) at Atlas Antibodies

Documents & Links for Anti GPM6A pAb (ATL-HPA017338)
Datasheet Anti GPM6A pAb (ATL-HPA017338) Datasheet (External Link)
Vendor Page Anti GPM6A pAb (ATL-HPA017338)