Anti GPI pAb (ATL-HPA024305 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA024305-25

• 
• 
• 

Protein Description: glucose-6-phosphate isomerase
Gene Name: GPI
Alternative Gene Name: AMF, NLK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036427: 96%, ENSRNOG00000023150: 94%
Entrez Gene ID: 2821
Uniprot ID: P06744
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQT
• Gene Sequence: LGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQT
• Gene ID - Mouse: ENSMUSG00000036427
• Gene ID - Rat: ENSRNOG00000023150
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GPI pAb (ATL-HPA024305 w/enhanced validation) – 1 Found

Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17.