Anti GPBP1L1 pAb (ATL-HPA028593)

Atlas Antibodies

Catalog No.:
ATL-HPA028593-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GC-rich promoter binding protein 1-like 1
Gene Name: GPBP1L1
Alternative Gene Name: SP192
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034042: 93%, ENSRNOG00000037595: 94%
Entrez Gene ID: 60313
Uniprot ID: Q9HC44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GMSQRSGGGTGNHRHWNGSFHSRKGCAFQEKPPMEIREEKKEDKVEKLQFEEEDFPSLNPEAGKQHQPCRPIGTPSGVWENPPSAKQP
Gene Sequence GMSQRSGGGTGNHRHWNGSFHSRKGCAFQEKPPMEIREEKKEDKVEKLQFEEEDFPSLNPEAGKQHQPCRPIGTPSGVWENPPSAKQP
Gene ID - Mouse ENSMUSG00000034042
Gene ID - Rat ENSRNOG00000037595
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPBP1L1 pAb (ATL-HPA028593)
Datasheet Anti GPBP1L1 pAb (ATL-HPA028593) Datasheet (External Link)
Vendor Page Anti GPBP1L1 pAb (ATL-HPA028593) at Atlas Antibodies

Documents & Links for Anti GPBP1L1 pAb (ATL-HPA028593)
Datasheet Anti GPBP1L1 pAb (ATL-HPA028593) Datasheet (External Link)
Vendor Page Anti GPBP1L1 pAb (ATL-HPA028593)