Anti GPBP1 pAb (ATL-HPA037773)

Atlas Antibodies

Catalog No.:
ATL-HPA037773-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: GC-rich promoter binding protein 1
Gene Name: GPBP1
Alternative Gene Name: DKFZp761C169, vasculin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032745: 96%, ENSRNOG00000013002: 99%
Entrez Gene ID: 65056
Uniprot ID: Q86WP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKALKRDRVEEEHEDESRAGSEKDDDSFNLHNSNSTHQERDINRNFDENEIPQENGNASVISQQIIRSSTFPQTDVLSSSL
Gene Sequence LKALKRDRVEEEHEDESRAGSEKDDDSFNLHNSNSTHQERDINRNFDENEIPQENGNASVISQQIIRSSTFPQTDVLSSSL
Gene ID - Mouse ENSMUSG00000032745
Gene ID - Rat ENSRNOG00000013002
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPBP1 pAb (ATL-HPA037773)
Datasheet Anti GPBP1 pAb (ATL-HPA037773) Datasheet (External Link)
Vendor Page Anti GPBP1 pAb (ATL-HPA037773) at Atlas Antibodies

Documents & Links for Anti GPBP1 pAb (ATL-HPA037773)
Datasheet Anti GPBP1 pAb (ATL-HPA037773) Datasheet (External Link)
Vendor Page Anti GPBP1 pAb (ATL-HPA037773)
Citations for Anti GPBP1 pAb (ATL-HPA037773) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed