Anti GPATCH2L pAb (ATL-HPA018856)

Atlas Antibodies

SKU:
ATL-HPA018856-25
  • Immunohistochemical staining of human bone marrow shows distinct positivity in bone marrow poietic cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G patch domain containing 2-like
Gene Name: GPATCH2L
Alternative Gene Name: C14orf118, FLJ10033, FLJ20689
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021254: 93%, ENSRNOG00000010227: 93%
Entrez Gene ID: 55668
Uniprot ID: Q9NWQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRRSDFTHLAEHTCCYSEASESSLDEATKDCREVAPVTNFSDSDDTMVAKRHPALNAIVKSKQHSWHESDSFTENAPCRPLRRRRKVKRVTSEVAASLQQKLKVSDWSYERGCRFKSAKK
Gene Sequence KRRSDFTHLAEHTCCYSEASESSLDEATKDCREVAPVTNFSDSDDTMVAKRHPALNAIVKSKQHSWHESDSFTENAPCRPLRRRRKVKRVTSEVAASLQQKLKVSDWSYERGCRFKSAKK
Gene ID - Mouse ENSMUSG00000021254
Gene ID - Rat ENSRNOG00000010227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPATCH2L pAb (ATL-HPA018856)
Datasheet Anti GPATCH2L pAb (ATL-HPA018856) Datasheet (External Link)
Vendor Page Anti GPATCH2L pAb (ATL-HPA018856) at Atlas Antibodies

Documents & Links for Anti GPATCH2L pAb (ATL-HPA018856)
Datasheet Anti GPATCH2L pAb (ATL-HPA018856) Datasheet (External Link)
Vendor Page Anti GPATCH2L pAb (ATL-HPA018856)