Anti GPATCH1 pAb (ATL-HPA043604)

Atlas Antibodies

SKU:
ATL-HPA043604-25
  • Immunohistochemical staining of human kidney shows moderate nuclear and cytoplasmic positivity in renal tubules and glomeruli.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: G patch domain containing 1
Gene Name: GPATCH1
Alternative Gene Name: ECGP, FLJ10206, FLJ38686, GPATC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063808: 88%, ENSRNOG00000011584: 88%
Entrez Gene ID: 55094
Uniprot ID: Q9BRR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TLKASNFKPFAKDPEKQKRYDEFLVHMKQGQKDALERCLDPSMTEWERGRERDEFARAALLYASSHSTLSSRFTHAKEEDDSDQVEVPRDQENDVGDKQSAVKMKMFGKLTR
Gene Sequence TLKASNFKPFAKDPEKQKRYDEFLVHMKQGQKDALERCLDPSMTEWERGRERDEFARAALLYASSHSTLSSRFTHAKEEDDSDQVEVPRDQENDVGDKQSAVKMKMFGKLTR
Gene ID - Mouse ENSMUSG00000063808
Gene ID - Rat ENSRNOG00000011584
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPATCH1 pAb (ATL-HPA043604)
Datasheet Anti GPATCH1 pAb (ATL-HPA043604) Datasheet (External Link)
Vendor Page Anti GPATCH1 pAb (ATL-HPA043604) at Atlas Antibodies

Documents & Links for Anti GPATCH1 pAb (ATL-HPA043604)
Datasheet Anti GPATCH1 pAb (ATL-HPA043604) Datasheet (External Link)
Vendor Page Anti GPATCH1 pAb (ATL-HPA043604)