Anti GPATCH1 pAb (ATL-HPA043430)

Atlas Antibodies

SKU:
ATL-HPA043430-25
  • Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: G patch domain containing 1
Gene Name: GPATCH1
Alternative Gene Name: ECGP, FLJ10206, FLJ38686, GPATC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063808: 85%, ENSRNOG00000011584: 85%
Entrez Gene ID: 55094
Uniprot ID: Q9BRR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVTPVDFTPKDNVHGLAYKGLDPHQALFGTSGEHFNLFSGGSERAGDLGEIGLNKGRKLGISGQAFGVGALEEEDDDIYATETLSKYDTVLKDE
Gene Sequence DVTPVDFTPKDNVHGLAYKGLDPHQALFGTSGEHFNLFSGGSERAGDLGEIGLNKGRKLGISGQAFGVGALEEEDDDIYATETLSKYDTVLKDE
Gene ID - Mouse ENSMUSG00000063808
Gene ID - Rat ENSRNOG00000011584
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPATCH1 pAb (ATL-HPA043430)
Datasheet Anti GPATCH1 pAb (ATL-HPA043430) Datasheet (External Link)
Vendor Page Anti GPATCH1 pAb (ATL-HPA043430) at Atlas Antibodies

Documents & Links for Anti GPATCH1 pAb (ATL-HPA043430)
Datasheet Anti GPATCH1 pAb (ATL-HPA043430) Datasheet (External Link)
Vendor Page Anti GPATCH1 pAb (ATL-HPA043430)