Anti GPAT4 pAb (ATL-HPA016471)

Atlas Antibodies

Catalog No.:
ATL-HPA016471-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glycerol-3-phosphate acyltransferase 4
Gene Name: GPAT4
Alternative Gene Name: AGPAT6, DKFZp586M1819, LPAAT-zeta, TSARG7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031545: 98%, ENSRNOG00000018077: 98%
Entrez Gene ID: 137964
Uniprot ID: Q86UL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESW
Gene Sequence FAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESW
Gene ID - Mouse ENSMUSG00000031545
Gene ID - Rat ENSRNOG00000018077
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPAT4 pAb (ATL-HPA016471)
Datasheet Anti GPAT4 pAb (ATL-HPA016471) Datasheet (External Link)
Vendor Page Anti GPAT4 pAb (ATL-HPA016471) at Atlas Antibodies

Documents & Links for Anti GPAT4 pAb (ATL-HPA016471)
Datasheet Anti GPAT4 pAb (ATL-HPA016471) Datasheet (External Link)
Vendor Page Anti GPAT4 pAb (ATL-HPA016471)