Anti GPAT2 pAb (ATL-HPA036841)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036841-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GPAT2
Alternative Gene Name: CT123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046338: 86%, ENSRNOG00000013906: 86%
Entrez Gene ID: 150763
Uniprot ID: Q6NUI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HQKGVFLSQLLGEFSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA |
| Gene Sequence | HQKGVFLSQLLGEFSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA |
| Gene ID - Mouse | ENSMUSG00000046338 |
| Gene ID - Rat | ENSRNOG00000013906 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GPAT2 pAb (ATL-HPA036841) | |
| Datasheet | Anti GPAT2 pAb (ATL-HPA036841) Datasheet (External Link) |
| Vendor Page | Anti GPAT2 pAb (ATL-HPA036841) at Atlas Antibodies |
| Documents & Links for Anti GPAT2 pAb (ATL-HPA036841) | |
| Datasheet | Anti GPAT2 pAb (ATL-HPA036841) Datasheet (External Link) |
| Vendor Page | Anti GPAT2 pAb (ATL-HPA036841) |
| Citations for Anti GPAT2 pAb (ATL-HPA036841) – 4 Found |
| Cattaneo, Elizabeth R; Prieto, Eduardo D; Garcia-Fabiani, Maria B; Montanaro, Mauro A; Guillou, Herve; Gonzalez-Baro, Maria R. Glycerol-3-phosphate acyltransferase 2 expression modulates cell roughness and membrane permeability: An atomic force microscopy study. Plos One. 12(12):e0189031. PubMed |
| Lacunza, Ezequiel; Montanaro, Mauro Aldo; Salvati, Annamaria; Memoli, Domenico; Rizzo, Francesca; Henning, Maria Florencia; Quiroga, Ivana Yoseli; Guillou, Hervé; Abba, Martín Carlos; Gonzalez-Baro, María Del Rosario; Weisz, Alessandro; Pellon-Maison, Magalí. Small non-coding RNA landscape is modified by GPAT2 silencing in MDA-MB-231 cells. Oncotarget. 2018;9(46):28141-28154. PubMed |
| Cattaneo, Elizabeth R; Pellon-Maison, Magali; Rabassa, Martin E; Lacunza, Ezequiel; Coleman, Rosalind A; Gonzalez-Baro, Maria R. Glycerol-3-phosphate acyltransferase-2 is expressed in spermatic germ cells and incorporates arachidonic acid into triacylglycerols. Plos One. 7(8):e42986. PubMed |
| Pellon-Maison, Magali; Montanaro, Mauro A; Lacunza, Ezequiel; Garcia-Fabiani, Maria B; Soler-Gerino, Mercedes C; Cattaneo, Elizabeth R; Quiroga, Ivana Y; Abba, Martin C; Coleman, Rosalind A; Gonzalez-Baro, Maria R. Glycerol-3-phosphate acyltranferase-2 behaves as a cancer testis gene and promotes growth and tumorigenicity of the breast cancer MDA-MB-231 cell line. Plos One. 9(6):e100896. PubMed |