Anti GPAT2 pAb (ATL-HPA036841)

Atlas Antibodies

Catalog No.:
ATL-HPA036841-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glycerol-3-phosphate acyltransferase 2, mitochondrial
Gene Name: GPAT2
Alternative Gene Name: CT123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046338: 86%, ENSRNOG00000013906: 86%
Entrez Gene ID: 150763
Uniprot ID: Q6NUI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HQKGVFLSQLLGEFSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA
Gene Sequence HQKGVFLSQLLGEFSWLTEEILLRGFDVGFSGQLRSLLQHSLSLLRAHVALLRIRQGDLLVVPQPGPGLTHLA
Gene ID - Mouse ENSMUSG00000046338
Gene ID - Rat ENSRNOG00000013906
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GPAT2 pAb (ATL-HPA036841)
Datasheet Anti GPAT2 pAb (ATL-HPA036841) Datasheet (External Link)
Vendor Page Anti GPAT2 pAb (ATL-HPA036841) at Atlas Antibodies

Documents & Links for Anti GPAT2 pAb (ATL-HPA036841)
Datasheet Anti GPAT2 pAb (ATL-HPA036841) Datasheet (External Link)
Vendor Page Anti GPAT2 pAb (ATL-HPA036841)
Citations for Anti GPAT2 pAb (ATL-HPA036841) – 4 Found
Cattaneo, Elizabeth R; Prieto, Eduardo D; Garcia-Fabiani, Maria B; Montanaro, Mauro A; Guillou, Herve; Gonzalez-Baro, Maria R. Glycerol-3-phosphate acyltransferase 2 expression modulates cell roughness and membrane permeability: An atomic force microscopy study. Plos One. 12(12):e0189031.  PubMed
Lacunza, Ezequiel; Montanaro, Mauro Aldo; Salvati, Annamaria; Memoli, Domenico; Rizzo, Francesca; Henning, Maria Florencia; Quiroga, Ivana Yoseli; Guillou, Hervé; Abba, Martín Carlos; Gonzalez-Baro, María Del Rosario; Weisz, Alessandro; Pellon-Maison, Magalí. Small non-coding RNA landscape is modified by GPAT2 silencing in MDA-MB-231 cells. Oncotarget. 2018;9(46):28141-28154.  PubMed
Cattaneo, Elizabeth R; Pellon-Maison, Magali; Rabassa, Martin E; Lacunza, Ezequiel; Coleman, Rosalind A; Gonzalez-Baro, Maria R. Glycerol-3-phosphate acyltransferase-2 is expressed in spermatic germ cells and incorporates arachidonic acid into triacylglycerols. Plos One. 7(8):e42986.  PubMed
Pellon-Maison, Magali; Montanaro, Mauro A; Lacunza, Ezequiel; Garcia-Fabiani, Maria B; Soler-Gerino, Mercedes C; Cattaneo, Elizabeth R; Quiroga, Ivana Y; Abba, Martin C; Coleman, Rosalind A; Gonzalez-Baro, Maria R. Glycerol-3-phosphate acyltranferase-2 behaves as a cancer testis gene and promotes growth and tumorigenicity of the breast cancer MDA-MB-231 cell line. Plos One. 9(6):e100896.  PubMed