Anti GPANK1 pAb (ATL-HPA006301)

Atlas Antibodies

SKU:
ATL-HPA006301-100
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
  • Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: G patch domain and ankyrin repeats 1
Gene Name: GPANK1
Alternative Gene Name: ANKRD59, BAT4, D6S54E, G5, GPATCH10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092417: 84%, ENSRNOG00000000848: 84%
Entrez Gene ID: 7918
Uniprot ID: O95872
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVCELSGRDAAQLAEEAGFPEVARMVRESHGETRSPENRSPTPSLQYCENCDTHFQDSNHRTSTAHLLSLSQGPQPPNLPLGVPISSPGFKLLLRGGWEPGMGLGPRGEGRANPIPTVLKRDQEGLGYRSAPQ
Gene Sequence GVCELSGRDAAQLAEEAGFPEVARMVRESHGETRSPENRSPTPSLQYCENCDTHFQDSNHRTSTAHLLSLSQGPQPPNLPLGVPISSPGFKLLLRGGWEPGMGLGPRGEGRANPIPTVLKRDQEGLGYRSAPQ
Gene ID - Mouse ENSMUSG00000092417
Gene ID - Rat ENSRNOG00000000848
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GPANK1 pAb (ATL-HPA006301)
Datasheet Anti GPANK1 pAb (ATL-HPA006301) Datasheet (External Link)
Vendor Page Anti GPANK1 pAb (ATL-HPA006301) at Atlas Antibodies

Documents & Links for Anti GPANK1 pAb (ATL-HPA006301)
Datasheet Anti GPANK1 pAb (ATL-HPA006301) Datasheet (External Link)
Vendor Page Anti GPANK1 pAb (ATL-HPA006301)